[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD99245.1"

            "Conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111-1111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNSERKERREVQLAKKAETIEAAASEVLVINETRIKIDGRPYDLVENYHEGFSAERLGER:Sequence : ccEEEETTEEEEEEEEETTcccHHHHHHH:Sec Str : $$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|35->119|PF06265|4e-26|58.8|85/86|DUF1027 61: . . . * . .: 120 :FSQILTKYDYIVGDWGYDQLRLRGFYEIGSKKGSPYQSIERLDDYLYEYCNFGCSYFILH:Sequence :ccGGGGGTcEEEEEcTTcccEEEEccccccTTcccTTccTTHHHHHHHcccccccEEEEE:Sec Str :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|35->119|PF06265|4e-26|58.8|85/86|DUF1027 121: . . + . . .: 180 :NLEVQTPEPIPANIRKKSSKRKSQSSSKKHNSKNNVFTNEKRYNIRSQKNKKNAHLKSVS:Sequence :EcTTTEEccccHHHH :Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|136->155|kksskrksqssskkhnsknn 181: . * . . . .: 240 :KKNTKHRHFTIRQK :Sequence : :Sec Str