[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99245.1 lsal0 ABD99245.1 "Conserved hypothetical protein"
MNSERKERREVQLAKKAETIEAAASEVLVINETRIKIDGRPYDLVENYHEGFSAERLGER
FSQILTKYDYIVGDWGYDQLRLRGFYEIGSKKGSPYQSIERLDDYLYEYCNFGCSYFILH
NLEVQTPEPIPANIRKKSSKRKSQSSSKKHNSKNNVFTNEKRYNIRSQKNKKNAHLKSVS
KKNTKHRHFTIRQK
//