[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD99260.1"

            "Transcriptional regulator, MarR family"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-11-1-----1111-1-111-1111111111111111111111111111111111111111111111---111111111111--11111111----11--------11-------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDERYQVINDALEKIYADIVWIEESELRKSVFSDITIKEMHAINAISMYDHQTASQVAKK:Sequence :HHHHTTcHHHHHHHHHHHHHHHHHHHTGGGHHHTccHHHHHHHHHHHHcTTccHHHHHHH:Sec Str : ===================================================:RP:SCP|10->143|2ethA1|2e-15|21.6|134/140|a.4.5.28 : ===========================:BL:SWS|34->132|MARR_ECOLI|5e-04|26.3|99/144 61: . . . * . .: 120 :LHLTPGTLTATIDRLCRKGYAERIRGNDDRRIIRIGLTKKGRLVYRAHDAFHRMMVKSFL:Sequence :HTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHT:Sec Str : XXXXXXXXXXXXXX :SEG|83->96|rirgnddrriirig :============================================================:RP:SCP|10->143|2ethA1|2e-15|21.6|134/140|a.4.5.28 :============================================================:BL:SWS|34->132|MARR_ECOLI|5e-04|26.3|99/144 121: . . + . . .: 180 :KDLNPDEIKTIEKAIHNLEDFLKEHS :Sequence :TTccHHHHHHHHHHHHHHHHHHHHc :Sec Str :======================= :RP:SCP|10->143|2ethA1|2e-15|21.6|134/140|a.4.5.28 :============ :BL:SWS|34->132|MARR_ECOLI|5e-04|26.3|99/144