[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD99322.1"

            "Hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1---1111---11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLRKTKNFLKANGVYYEKEHVNPLMVPERVYVLKFGIDEKTMNNRFIVEYTYTWTGRIKI:Sequence : ================================:BL:SWS|29->106|RNC_CLOTE|5e-04|34.6|78/100 61: . . . * . .: 120 :NKISLRLHGQQHPREFRNEAQLLQYLKKHSKRYVKGKEISNKKRSK :Sequence :============================================== :BL:SWS|29->106|RNC_CLOTE|5e-04|34.6|78/100