[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99322.1 lsal0 ABD99322.1 "Hypothetical protein"
MLRKTKNFLKANGVYYEKEHVNPLMVPERVYVLKFGIDEKTMNNRFIVEYTYTWTGRIKI
NKISLRLHGQQHPREFRNEAQLLQYLKKHSKRYVKGKEISNKKRSK
//