[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD99438.1"

            "Signal recognition particle associated protein"
Y628_LACS1  "RecName: Full=UPF0122 protein LSL_0628;"

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-111-1111111111111111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-------------1------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAIEKTNRINALFDFYEPLLTPKQMTYIGLYYRDDYSLGEIAENYEVSRQAVYDNIRRTE:Sequence : ccccHHHHHHHHHHGGGccHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHH:Sec Str : =========================================================:RP:SCP|4->112|1s7oA|3e-04|56.2|105/106|a.4.13.3 :============================================================:BL:SWS|1->112|Y628_LACS1|1e-61|100.0|112/112 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->92|PF04297|2e-20|64.4|90/100|UPF0122 61: . . . * . .: 120 :KILEEYESKLHLYRNFQLQSEELDNLLKYVEENYAYDKELLTRINRLESLEE :Sequence :HHHHHHHHHHcHHHHHHHHHHHHHHHHHH TTccTTcHHHHHHHHHHHHHH :Sec Str :==================================================== :RP:SCP|4->112|1s7oA|3e-04|56.2|105/106|a.4.13.3 :==================================================== :BL:SWS|1->112|Y628_LACS1|1e-61|100.0|112/112 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|3->92|PF04297|2e-20|64.4|90/100|UPF0122