[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99438.1 lsal0 ABD99438.1 "Signal recognition particle associated protein"
MAIEKTNRINALFDFYEPLLTPKQMTYIGLYYRDDYSLGEIAENYEVSRQAVYDNIRRTE
KILEEYESKLHLYRNFQLQSEELDNLLKYVEENYAYDKELLTRINRLESLEE
//