[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD99450.1"

            "Metallo-beta-lactamase superfamily protein"
            ""

OrgPattern ------11111111111-------1111111111112111111111111211111111111----1-- 1111111111111111111-11111111111-111111111111212112211111111111111111111111111111111-----------------------------------------------------1111111111111111111111111111111111111111111111111-1111-12232324333333333322222243222231222222223222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222212113222222222211111111111111112122121121111112111---111111111111111111111111111111111-111121111111111111111111111111111111111111111111111112111111111111111111111111111111111111------------------------------------------------------------------------111-1111111111111111111111112-11111111111111111111111111-----1---------------------------------------------------------------------------------------------------------------------------------------1--11------------------------------------------------------------------------------------11----------------222222-2222222222222222222------------- ------1--------------------------------------------------------------------------------------------------------1---1------1-1---1231------------------------------------------1-1118111111--2-11------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSDIKIISLGGVRENAKNMYAVEVDDEIFILDCGLKYPENELLGIDFVIPDFSYLRENSR:Sequence :cccEEEEEEEccccccccEEEEEETTEEEEEccccccccTTTcTccEEEEccHHHHHcGG:Sec Str : ===========================================================:RP:SCP|2->421|2i7tA1|2e-46|13.8|383/404|d.157.1.10 : ==========================================================:BL:SWS|3->552|RNJ2_STAHJ|e-143|45.4|548/557 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|18->164|PF00753|1e-09|29.7|138/171|Lactamase_B 61: . . . * . .: 120 :KIVGVFLTHGHADAIGALPYFVSEFDVPVFGSELTIELAKIACENEEDARKFDDFHVIDE:Sequence :GEEEEEcccccHHHHTTHHHHHHHTcccEEEcHHHHHHHHHHHHHTTccTTcEEEEEccT:Sec Str :============================================================:RP:SCP|2->421|2i7tA1|2e-46|13.8|383/404|d.157.1.10 :============================================================:BL:SWS|3->552|RNJ2_STAHJ|e-143|45.4|548/557 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|18->164|PF00753|1e-09|29.7|138/171|Lactamase_B 121: . . + . . .: 180 :STEIDFENATISFFQTTHSIPESLGVVIKTENGNVVYTGDFKFDQSAEKGYRTDYARLTE:Sequence :TcEEEETTTEEEEEEEcccccccEEEEEEETTEEEEEccccccccccTTccccccHHHHH:Sec Str :============================================================:RP:SCP|2->421|2i7tA1|2e-46|13.8|383/404|d.157.1.10 :============================================================:BL:SWS|3->552|RNJ2_STAHJ|e-143|45.4|548/557 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|18->164|PF00753|1e-09|29.7|138/171|Lactamase_B 181: . * . . . .: 240 :IGREGVLALLSESANAENPRETVNERAIYDFISENFEYRKGRIIVACVASNILRVQQIFN:Sequence :HHHHcccEEEEEcTcTTcccccccHHHHHHHHHHHHTcccccEEEEccTTcHHHHHHHHH:Sec Str :============================================================:RP:SCP|2->421|2i7tA1|2e-46|13.8|383/404|d.157.1.10 :============================================================:BL:SWS|3->552|RNJ2_STAHJ|e-143|45.4|548/557 241: + . . . . *: 300 :AAAANNRKVALTGHDVEKVVKTAMRLNKLVLPEEDLLIPIKKINDYNDDEIVILETGRSG:Sequence :HHHHTTcEEEEcHHHHHHHHHHHHHHTccccccccccccHHHHTTccGGGEEEEEccTTc:Sec Str :============================================================:RP:SCP|2->421|2i7tA1|2e-46|13.8|383/404|d.157.1.10 :============================================================:BL:SWS|3->552|RNJ2_STAHJ|e-143|45.4|548/557 301: . . . . + .: 360 :EPLKSLQKMAMGRHRFVNLHEGDLVFITTTPSHAMETKVARTRDMIYRSGADVKAIFDEL:Sequence :ccHHHHHHHHHTTcccccccTTcEEEEcccccTTcHHHHHHHHHHHHHTTcEEEcTTTcc:Sec Str :============================================================:RP:SCP|2->421|2i7tA1|2e-46|13.8|383/404|d.157.1.10 :============================================================:BL:SWS|3->552|RNJ2_STAHJ|e-143|45.4|548/557 : $$$$$$$$:RP:PFM|353->390|PF07521|3e-09|57.9|38/42|RMMBL 361: . . . * . .: 420 :NSSGHASKNDLQLMMNLVKPRYVIPVQGEYRMLSAHAELARELGIPSENIFLLKKGDVLE:Sequence :cccccccHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHTcccccEEccccTTEEEE:Sec Str :============================================================:RP:SCP|2->421|2i7tA1|2e-46|13.8|383/404|d.157.1.10 :============================================================:BL:SWS|3->552|RNJ2_STAHJ|e-143|45.4|548/557 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|353->390|PF07521|3e-09|57.9|38/42|RMMBL 421: . . + . . .: 480 :YKKDEMTISSSVEVGNTMIDGTGVGDIGNIVLRDRKILSEDGIFIAVVTIDRKKRKIVDT:Sequence :EccccEEEEEEccccEEEEETTEEccccHHHHHHHHcHHHHcEEEEEEEEccccEcEccc:Sec Str := :RP:SCP|2->421|2i7tA1|2e-46|13.8|383/404|d.157.1.10 :============================================================:BL:SWS|3->552|RNJ2_STAHJ|e-143|45.4|548/557 481: . * . . . .: 540 :PKITSRGFVYIKTSKDLMVESRDIVAKIVQRDLDNKEFDWSQLKQDIRENLNNFLYEQTK:Sequence :EEEEEEcccHHcHHHTTHHHHHHHHHHHHHHHHTTTTccHHHHHHHHHHHHHHHHHHHHc:Sec Str :============================================================:BL:SWS|3->552|RNJ2_STAHJ|e-143|45.4|548/557 541: + . . . . *: 600 :RHPVILPVIMEINQNNHFSKKKKKG :Sequence :ccc EEEEEEE :Sec Str :============ :BL:SWS|3->552|RNJ2_STAHJ|e-143|45.4|548/557