[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99450.1 lsal0 ABD99450.1 "Metallo-beta-lactamase superfamily protein"
MSDIKIISLGGVRENAKNMYAVEVDDEIFILDCGLKYPENELLGIDFVIPDFSYLRENSR
KIVGVFLTHGHADAIGALPYFVSEFDVPVFGSELTIELAKIACENEEDARKFDDFHVIDE
STEIDFENATISFFQTTHSIPESLGVVIKTENGNVVYTGDFKFDQSAEKGYRTDYARLTE
IGREGVLALLSESANAENPRETVNERAIYDFISENFEYRKGRIIVACVASNILRVQQIFN
AAAANNRKVALTGHDVEKVVKTAMRLNKLVLPEEDLLIPIKKINDYNDDEIVILETGRSG
EPLKSLQKMAMGRHRFVNLHEGDLVFITTTPSHAMETKVARTRDMIYRSGADVKAIFDEL
NSSGHASKNDLQLMMNLVKPRYVIPVQGEYRMLSAHAELARELGIPSENIFLLKKGDVLE
YKKDEMTISSSVEVGNTMIDGTGVGDIGNIVLRDRKILSEDGIFIAVVTIDRKKRKIVDT
PKITSRGFVYIKTSKDLMVESRDIVAKIVQRDLDNKEFDWSQLKQDIRENLNNFLYEQTK
RHPVILPVIMEINQNNHFSKKKKKG
//