[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD99526.1"

            "Conserved hypothetical protein"
Y716_LACS1  "RecName: Full=UPF0346 protein LSL_0716;"

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-111111-111--11111-111111--111111---111111111111-1-11--111111111111111111111111111-11-1-11-1111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSKRQSFYQFLMTERNPDSTDEIAQFANNAFYDQSFPKQADDYDSLSQYLELNGTYLPSM:Sequence : cTHHHHHHTTcccccccHHHHHHHHHHTcTTccTTcccHHHHHHHHHTcHHHHTTH:Sec Str : ========================================================:RP:SCP|5->72|2fj6A1|3e-10|50.0|68/74|a.60.15.1 :============================================================:BL:SWS|1->75|Y716_LACS1|2e-41|100.0|75/75 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->70|PF06855|1e-09|65.9|44/46|DUF1250 61: . . . * . .: 120 :VIFDNAWTKYEEFMS :Sequence :HHHHHHHHHHHHHH :Sec Str :============ :RP:SCP|5->72|2fj6A1|3e-10|50.0|68/74|a.60.15.1 :=============== :BL:SWS|1->75|Y716_LACS1|2e-41|100.0|75/75 :$$$$$$$$$$ :RP:PFM|27->70|PF06855|1e-09|65.9|44/46|DUF1250