[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99526.1 lsal0 ABD99526.1 "Conserved hypothetical protein"
MSKRQSFYQFLMTERNPDSTDEIAQFANNAFYDQSFPKQADDYDSLSQYLELNGTYLPSM
VIFDNAWTKYEEFMS
//