[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD99574.1"

            "Hypothetical protein, phage associated"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------1-------------------------1------------1----------------------------------------------------1----------1-----------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------1-------------------------------------------------1-------------1-----------------------------------------------------------------------------------------------------------------------------------------------------11---------1--------------------------1---------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRIKLNPKIINWLEENVPGRPWKETFRMFKQEFPDLEWSLDSMKHSCYRRGIRNEIDSRY:Sequence : :Sec Str 61: . . . * . .: 120 :KKGHKSWCAGMKGLRIPGSEKGWFNEGRRPPNERPLGSERKYGKYTLVKVKRDGSKYEKW:Sequence : EEEEEEcccccccccTTEEEEETTEEEEEEEETTEE EE:Sec Str : ==================================================:RP:SCP|71->164|1u3eM1|2e-09|18.5|92/105|d.4.1.3 : ===================:BL:SWS|102->161|Y53_BPT3|8e-06|37.0|54/101 121: . . + . . .: 180 :KPKQVHIWEQHNGPLPKGYIITFIDGDKSNLNIDNLACIKKSVNGAMNIKSLRSESPELF:Sequence :EETTTGGGTTccEETTEEEEEEETTccTTcccGGGEEEEEHHHHHHGGGcccTTTT :Sec Str :============================================ :RP:SCP|71->164|1u3eM1|2e-09|18.5|92/105|d.4.1.3 :========================================= :BL:SWS|102->161|Y53_BPT3|8e-06|37.0|54/101 181: . * . . . .: 240 :KVRVAQIELDQKIKKITKNLGSD :Sequence : :Sec Str