[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99574.1 lsal0 ABD99574.1 "Hypothetical protein, phage associated"
MRIKLNPKIINWLEENVPGRPWKETFRMFKQEFPDLEWSLDSMKHSCYRRGIRNEIDSRY
KKGHKSWCAGMKGLRIPGSEKGWFNEGRRPPNERPLGSERKYGKYTLVKVKRDGSKYEKW
KPKQVHIWEQHNGPLPKGYIITFIDGDKSNLNIDNLACIKKSVNGAMNIKSLRSESPELF
KVRVAQIELDQKIKKITKNLGSD
//