[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD99654.1"

            "Hypothetical secreted protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNSSKKVFIGVENLRKEIFAAAILAGIILTGARSQSVQAEVLSTDSNNVTEVETSKVANN:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|18->32|ifaaailagiiltga 61: . . . * . .: 120 :KQLTQNISMSKENQTHDSSSMVSAGETSDVNEVQENKSETISNDMSDLQVQLTSLYVDLQ:Sequence : :Sec Str 121: . . + . . .: 180 :PKQMAFKTVAATNDAKSILVSTKSTKQKAKKILDDKKKDLDTAKCNLDKTNKALANTQIK:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|145->164|tkqkakkilddkkkdldtak 181: . * . . . .: 240 :VTVNQEVAKNAQKELDSLNADLTAKQADYDKADKDLNDAKVNYQVKKAILASTKEDKSKL:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|204->215|akqadydkadkd : XXXX:SEG|237->250|ksklkkelanaeek 241: + . . . . *: 300 :KKELANAEEKQTSAKKVFKTSKKKLTSLKEKVAQAKEDLDKVQAKLAKDQKNEQKAKENI:Sequence : HHHHcHHHHHHHHTTTcGGGHHHHHHH:Sec Str :XXXXXXXXXX :SEG|237->250|ksklkkelanaeek : XXXXXXXXXXXXXXXXXX :SEG|255->272|kkvfktskkkltslkekv : ============================:BL:SWS|273->401|MRP4_STRPY|7e-09|28.6|126/388 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|273->377|PF05667|7e-06|27.7|101/491|DUF812 301: . . . . + .: 360 :AKLEADIKTKQADYDKAKQEISTKQEALKKSQTELAEQKKVKAHAKKVLDKANKELIKVQ:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHTTGGGcccccTTTcTTHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:BL:SWS|273->401|MRP4_STRPY|7e-09|28.6|126/388 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|273->377|PF05667|7e-06|27.7|101/491|DUF812 361: . . . * . .: 420 :ATVQDKQAKLKELQDQFGNYVGDDDELADTKKSLTEAQTKLTQAQKNQADAQKDYDKAQA:Sequence :HHHHHHHHTccccHHHHHHHHHHHHHHHHHTT :Sec Str : XXXXXXXXXXXXXXXXXX:SEG|403->422|qaqknqadaqkdydkaqady :========================================= :BL:SWS|273->401|MRP4_STRPY|7e-09|28.6|126/388 :$$$$$$$$$$$$$$$$$ :RP:PFM|273->377|PF05667|7e-06|27.7|101/491|DUF812 421: . . + . . .: 480 :DYETKLKKH :Sequence : :Sec Str :XX :SEG|403->422|qaqknqadaqkdydkaqady