[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99654.1 lsal0 ABD99654.1 "Hypothetical secreted protein"
MNSSKKVFIGVENLRKEIFAAAILAGIILTGARSQSVQAEVLSTDSNNVTEVETSKVANN
KQLTQNISMSKENQTHDSSSMVSAGETSDVNEVQENKSETISNDMSDLQVQLTSLYVDLQ
PKQMAFKTVAATNDAKSILVSTKSTKQKAKKILDDKKKDLDTAKCNLDKTNKALANTQIK
VTVNQEVAKNAQKELDSLNADLTAKQADYDKADKDLNDAKVNYQVKKAILASTKEDKSKL
KKELANAEEKQTSAKKVFKTSKKKLTSLKEKVAQAKEDLDKVQAKLAKDQKNEQKAKENI
AKLEADIKTKQADYDKAKQEISTKQEALKKSQTELAEQKKVKAHAKKVLDKANKELIKVQ
ATVQDKQAKLKELQDQFGNYVGDDDELADTKKSLTEAQTKLTQAQKNQADAQKDYDKAQA
DYETKLKKH
//