[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD99691.1"

            "ABC transporter, permease protein"
            ""

OrgPattern -------------------------------------------------------------------- 11---------1-------------------------------1-------------------------------------------------------1--1--------------------------------------11-------------------------------------------------111111111112112221111-112111111-1111111-1-111111111111111---1111-22--1-111--2211-11-111----------11111111111----------------------1---------------1----1111--1--1--------------------1---11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRLLHKLLLVAKETYIRQVKSWSFLFLVLSPFIFIGLSATISYFGAKMTPDDQIAIVSTD:Sequence 61: . . . * . .: 120 :KTIQSQLKHHDTFTWKYKSVEDAKKAMKDDKIVGYVYIKSDSQKIAANYYGNDEMSSTDE:Sequence 121: . . + . . .: 180 :VKIRQILQSKQATLNIVNAGLDKQQLQQLSIQPQYKKHIAKKAVDKKTVQSISYMILSFL:Sequence : XXXXXXXXXXXXXX :SEG|141->154|ldkqqlqqlsiqpq : XXXXXXXXXXXX :SEG|156->167|kkhiakkavdkk : =====:BL:SWS|176->347|YHAP_BACSU|2e-25|35.3|167/419 181: . * . . . .: 240 :MYIVILTYAATTAQEIAAEKGTKIMEVIFSSMSATKYFYGKILGILGVILTHTGIYLLGG:Sequence :============================================================:BL:SWS|176->347|YHAP_BACSU|2e-25|35.3|167/419 241: + . . . . *: 300 :IAIYPFIINLDMVSKFKDMIGDILLNLVSVNLIYVVLGIIIYTILAAFFGALVVRVEDTS:Sequence :============================================================:BL:SWS|176->347|YHAP_BACSU|2e-25|35.3|167/419 301: . . . . + .: 360 :KAIQPITILIIASFLSSMVFINNPSSMIVKVLSYVPFLSSFFMPIRVIDNSVSIIEISIS:Sequence : XXXXXXXXXXXXX:SEG|348->363|idnsvsiieisislai :=============================================== :BL:SWS|176->347|YHAP_BACSU|2e-25|35.3|167/419 361: . . . * . .: 420 :LAILFATTALMTSYISKIYFGLILQSDDVGIWKNFRRGLKFK :Sequence :XXX :SEG|348->363|idnsvsiieisislai