[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99691.1 lsal0 ABD99691.1 "ABC transporter, permease protein"
MRLLHKLLLVAKETYIRQVKSWSFLFLVLSPFIFIGLSATISYFGAKMTPDDQIAIVSTD
KTIQSQLKHHDTFTWKYKSVEDAKKAMKDDKIVGYVYIKSDSQKIAANYYGNDEMSSTDE
VKIRQILQSKQATLNIVNAGLDKQQLQQLSIQPQYKKHIAKKAVDKKTVQSISYMILSFL
MYIVILTYAATTAQEIAAEKGTKIMEVIFSSMSATKYFYGKILGILGVILTHTGIYLLGG
IAIYPFIINLDMVSKFKDMIGDILLNLVSVNLIYVVLGIIIYTILAAFFGALVVRVEDTS
KAIQPITILIIASFLSSMVFINNPSSMIVKVLSYVPFLSSFFMPIRVIDNSVSIIEISIS
LAILFATTALMTSYISKIYFGLILQSDDVGIWKNFRRGLKFK
//