[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99735.1 lsal0 ABD99735.1 "Hypothetical protein"
MHSLFFHNFCILSESFCVCNLKLIILIAKFSIIIDYQIVLFINQHRIIFYSRNCYYAIII
TYSFIDYLMSLTITK
//