[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD99736.1"

            "Zwittermicin A resistance protein zmaR"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--12--11-111-----11-2---2-------------------------------------------------1-------111----1---11---11-1--------------111---111------------------------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKEQTMQKVHSLFTGWNQTIIWSCLDGTMGQIIVDDDSNPQSALAILGINSAFAFFAGKP:Sequence : HHHHHHHcccccHHHHHHHHcc cEEEEcccccccEEEEEEEcccEEEEEEEcc:Sec Str :============================================================:BL:SWS|1->248|YDFB_BACSU|2e-12|24.2|236/100 61: . . . * . .: 120 :NLNLITTAVDACSDLIMVPQNTEWANMIEKYCGEQVRKFTRYATLKDTKFDIPRLQLNIE:Sequence :cHHHHHHHTT ccEEEEEccHHHHHHHHHHHGGGEEEEEEEEEccccccccccccHHHH:Sec Str :============================================================:BL:SWS|1->248|YDFB_BACSU|2e-12|24.2|236/100 121: . . + . . .: 180 :KLPPEFQIHSIDANLYDQCLQKEWSTDLVGNYSNYNEFKKLGLGYVIVNDQSIVAGASSF:Sequence :HHHHHHHHHHHHHHHHHHHccccccHHHHHHcccTTccTTcTTcEEEEEETTEEEEEEEE:Sec Str : ================:RP:SCP|165->240|1yr0A1|3e-08|25.0|76/163|d.108.1.1 :============================================================:BL:SWS|1->248|YDFB_BACSU|2e-12|24.2|236/100 181: . * . . . .: 240 :SSYQNGIEIEVATHPDFQRRGLATIACSQLIITCLDQSLYPSWDAHTEISLHLAQKLGYQ:Sequence :EcTTccEEEEEEEcGGGTTccHHHHHHHHHHHcTTccEEEEEEETTcHHHHHHHHHHTcE:Sec Str :============================================================:RP:SCP|165->240|1yr0A1|3e-08|25.0|76/163|d.108.1.1 :============================================================:BL:SWS|1->248|YDFB_BACSU|2e-12|24.2|236/100 241: + . . . . *: 300 :FAYKYLAYEIEE :Sequence :EEEEEEEETTc :Sec Str :======== :BL:SWS|1->248|YDFB_BACSU|2e-12|24.2|236/100