[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99736.1 lsal0 ABD99736.1 "Zwittermicin A resistance protein zmaR"
MKEQTMQKVHSLFTGWNQTIIWSCLDGTMGQIIVDDDSNPQSALAILGINSAFAFFAGKP
NLNLITTAVDACSDLIMVPQNTEWANMIEKYCGEQVRKFTRYATLKDTKFDIPRLQLNIE
KLPPEFQIHSIDANLYDQCLQKEWSTDLVGNYSNYNEFKKLGLGYVIVNDQSIVAGASSF
SSYQNGIEIEVATHPDFQRRGLATIACSQLIITCLDQSLYPSWDAHTEISLHLAQKLGYQ
FAYKYLAYEIEE
//