[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD99824.1"

            "Conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------11----------------------------------------------------------11---------------------------------------------------------------------------1-111111-----------------------1-----------11---12111--------------------------------------------------11-----------2------1------------------------------------------1--------------------------------1--1--------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------1-2--------------1--------------1---2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNSTLNIAPDNLTLAFQPIVRIVNEDTFEISDYEVLLRSKDKKSFPAAIFEKIVNNESCN:Sequence : TEEcHTTTTEEEEEEEEEEcHccccccEEEEEEEEEETTEEEEcHHHHccccccHHHH:Sec Str : ====================================================:RP:SCP|9->241|2basA1|7e-20|19.3|218/257|c.1.33.1 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|14->232|PF00563|5e-09|28.5|200/236|EAL 61: . . . * . .: 120 :QMFWEWFTLEIKKVLTDKKVRVDINIDPHQFLYQSTWDFLDKMVEYNQQITIEITERVSQ:Sequence :HHHHHHHccHHHHHHHHTTcEEEEccHHHHGGTTHHHHHHHHHHHHTTGEEEEEccTTcc:Sec Str :============================================================:RP:SCP|9->241|2basA1|7e-20|19.3|218/257|c.1.33.1 : =============================================:BL:SWS|76->232|PHY2_SYNY3|2e-08|27.6|152/1276 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|14->232|PF00563|5e-09|28.5|200/236|EAL 121: . . + . . .: 180 :ELNLKKGLIDTVKHIKDLGYRVALDDISSGQYSFKVVQENIKGIDRVKLSLLIFNDDSTD:Sequence :cEcccHHHHHHHHHHHTTTcEEEEEEETTTcccHHHHHHHHHcccEEEEEcTTTcccHHH:Sec Str :============================================================:RP:SCP|9->241|2basA1|7e-20|19.3|218/257|c.1.33.1 :============================================================:BL:SWS|76->232|PHY2_SYNY3|2e-08|27.6|152/1276 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|14->232|PF00563|5e-09|28.5|200/236|EAL 181: . * . . . .: 240 :SKTKNFFIMSWINFAKTNNVELVIEGIEDDVAAKEMLCHNIKLQQGFFWQVPQDYISPKE:Sequence :HTcHHHHHHHHHHHHHHHTcEEEEEccccHHHHHHHHHTTEEEEccTTTccccc :Sec Str :============================================================:RP:SCP|9->241|2basA1|7e-20|19.3|218/257|c.1.33.1 :==================================================== :BL:SWS|76->232|PHY2_SYNY3|2e-08|27.6|152/1276 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|14->232|PF00563|5e-09|28.5|200/236|EAL 241: + . . . . *: 300 :VHNFKEFE :Sequence : :Sec Str := :RP:SCP|9->241|2basA1|7e-20|19.3|218/257|c.1.33.1