[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD99842.1"

            "Peptidoglycan binding protein, LysM domain"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1242--222324433--231-1----111----1111--11111111--------------11111111---------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKLNKTLLSLTAATGIIATGAAANGAKADKITVKSSDTVSQLALDHATTVDNVQQLNNLE:Sequence : ccTTccHHHHHHHHTccHHHHHHHHTcc:Sec Str : XXXXXXXXXXXXXXXXXXXXXX :SEG|11->32|taatgiiatgaaangakadkit : ============================:RP:SCP|33->71|1e0gA|1e-04|24.3|37/48|d.7.1.1 : ============================:BL:SWS|33->73|LYS_BPPZA|2e-04|46.3|41/258 61: . . . * . .: 120 :NVDLIFVGQTLEMGDGSYTTTTYQTASQYQQNYAQNTDAQANYTQTDYSAAQNNVPAATD:Sequence :ccccGGGcccE :Sec Str : XXXXXXXXXXXXXXXXXXXXX :SEG|77->97|syttttyqtasqyqqnyaqnt : XXXXX:SEG|116->145|paatdqvqdttttvdqtatpadtttqdaqt :=========== :RP:SCP|33->71|1e0gA|1e-04|24.3|37/48|d.7.1.1 :============= :BL:SWS|33->73|LYS_BPPZA|2e-04|46.3|41/258 121: . . + . . .: 180 :QVQDTTTTVDQTATPADTTTQDAQTNVASDTTTSEVQVDATNTDQAATTTNDAVSTGATT:Sequence : :Sec Str :XXXXXXXXXXXXXXXXXXXXXXXXX :SEG|116->145|paatdqvqdttttvdqtatpadtttqdaqt : XXXXXXXXXXXXXXXXXX :SEG|157->174|qvdatntdqaatttndav : XXXXX:SEG|176->194|tgatttqaqaevqapattt 181: . * . . . .: 240 :TQAQAEVQAPATTTYVENTPAEAPTTTWTDTTSSVNNTVANTNSNYSSASTTPAATTTAT:Sequence : :Sec Str :XXXXXXXXXXXXXX :SEG|176->194|tgatttqaqaevqapattt : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX:SEG|196->255|ventpaeaptttwtdttssvnntvantnsnyssasttpaatttatqntttsstssdedaa 241: + . . . . *: 300 :QNTTTSSTSSDEDAAREWIANKESGGSYTAKNGIYYGKYQLTATYLNGDYSAENQEKVAN:Sequence : :Sec Str :XXXXXXXXXXXXXXX :SEG|196->255|ventpaeaptttwtdttssvnntvantnsnyssasttpaatttatqntttsstssdedaa 301: . . . . + .: 360 :EYVASRYGSWTAAKAHWEANNWY :Sequence : :Sec Str