[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99842.1 lsal0 ABD99842.1 "Peptidoglycan binding protein, LysM domain"
MKLNKTLLSLTAATGIIATGAAANGAKADKITVKSSDTVSQLALDHATTVDNVQQLNNLE
NVDLIFVGQTLEMGDGSYTTTTYQTASQYQQNYAQNTDAQANYTQTDYSAAQNNVPAATD
QVQDTTTTVDQTATPADTTTQDAQTNVASDTTTSEVQVDATNTDQAATTTNDAVSTGATT
TQAQAEVQAPATTTYVENTPAEAPTTTWTDTTSSVNNTVANTNSNYSSASTTPAATTTAT
QNTTTSSTSSDEDAAREWIANKESGGSYTAKNGIYYGKYQLTATYLNGDYSAENQEKVAN
EYVASRYGSWTAAKAHWEANNWY
//