[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD99890.1"

            "DNA-3-methyladenine glycosylase"
            ""

OrgPattern ---------------------------------1---------------1-----------------1 --1-111222211111111-11111111111111111111111111-2-111111111--111-1121111-----11--11------1111-1--1--1-11111-1-1--------------1---------------------1-------------------------------------------11-----------------11----------11-11111111-11111111111111111111212-22-111133112221211111-11111111111111111111111111111111112112111111--1-1---1-11---1----------1-1----11--------111------111111111111111111111111111111-111-11111111111-11121111111111112111111111111111111-----111--------------------------------1--111121111112111111121111111111111--111-11111-1-1-11--1-11-1111111----11-2111-11-11111-1-11-11-11111--1--211--------1--------1-----1111111111-1111111111111111111------1------1111111111111-111-1111111111111111111111111111111111111111111111111111-111111111111---111111111111212111111-1111---11111111---11111111121111111111----1----111111111111111111211111-------1----11----------1----1-------------1-----------------11 ----11------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------256D-73------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKCAWIYGADQLMIDYHDKEWGRPLHDERGLFELLCLEGLQAGLSWKIVLNKRKFLREAF:Sequence : ccccc cHHHHHEETTcEETTEEHcccccHHHHHHHHHHHTTccccEEEEccccccccc:Sec Str : ===========================================================:RP:SCP|2->180|1lmzA|4e-60|49.4|178/187|a.96.1.4 : ===========================================================:BL:SWS|2->179|3MGA_HAEIN|1e-47|46.3|177/185 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->180|PF03352|1e-61|58.4|173/179|Adenine_glyco 61: . . . * . .: 120 :DNFEVEKISQYTLDDVEKLLTDPRIIRNRRKIEAIINNAKIVNALHERNESLDSFFWGII:Sequence :cccEEEEEEEEEHHHHHHHHcccEEEEEEEEEcccHHHHHHHHHHTHTTccHHHHHHHTT:Sec Str :============================================================:RP:SCP|2->180|1lmzA|4e-60|49.4|178/187|a.96.1.4 :============================================================:BL:SWS|2->179|3MGA_HAEIN|1e-47|46.3|177/185 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->180|PF03352|1e-61|58.4|173/179|Adenine_glyco 121: . . + . . .: 180 :NNQPIINNFKNPEEIPTKTKLSEQISKTLKKMGFKFVGPTIVYSFMEASGMVNDHLVGCY:Sequence :TTccEEcccccTTTcccccHHHHHHHHHHHHHTcccccHHHHHHHHHHHTcEEcccTTcT:Sec Str :============================================================:RP:SCP|2->180|1lmzA|4e-60|49.4|178/187|a.96.1.4 :=========================================================== :BL:SWS|2->179|3MGA_HAEIN|1e-47|46.3|177/185 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->180|PF03352|1e-61|58.4|173/179|Adenine_glyco 181: . * . . . .: 240 :GRN :Sequence : :Sec Str