[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD99944.1"

            "23S rRNA methyltransferase"
            ""

OrgPattern -------------------------------------------------------------------- -----11111111111111-111111111111111111111----11-1---111111-------11----11111111-11-------------------11-------111111111111111---------------------1111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111112211111111111111111111111111111111111-111111111111111111-111-1111-11111111111111111111111111111-11111111111-111111111111111-1-1----------------------11-----------------------------1111-11111111111111111111111111111111111111111111111111111111111111111111111111--11111111111111111111----11-111-11111111-1-------1111111111111111111111111111111111111--111-1------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111----------1----1-111-111111111111111----------111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111116111-121-2-11------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MANHIVLFEPLMPANTGNIARTCAGTNTELHLIEPLGFSTDDKYMKRAGLDYWDKVKITY:Sequence : EEEEEccccHHHHHHHHHHHHHHTcEEEEEccccccccHHHHHHTTccHHHHHTcEE:Sec Str : =========================================================:RP:SCP|4->169|1v2xA|2e-37|29.4|153/192|c.116.1.1 :============================================================:BL:SWS|1->165|Y956_LISMF|9e-56|60.1|163/169 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->147|PF00588|4e-04|27.5|138/143|SpoU_methylase 61: . . . * . .: 120 :HPNLPAFLETIPENGELYIVSKFASKAYTEADYTNTEKEHYFLFGKETTGLPEMFMRQNP:Sequence :EccHHHHHHHHcccGGEEEEccTTcEEGGGcccccccTTcEEEEEcTTTcccHHHTTccG:Sec Str :============================================================:RP:SCP|4->169|1v2xA|2e-37|29.4|153/192|c.116.1.1 :============================================================:BL:SWS|1->165|Y956_LISMF|9e-56|60.1|163/169 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->147|PF00588|4e-04|27.5|138/143|SpoU_methylase 121: . . + . . .: 180 :EKCIRIPQNDEHIRALNLSNTAAIVVYEALRQQGFPNLETTHTYENDKLK :Sequence :GGEEEccccccccccccHHHHHHHHHHHHHHHTTTT :Sec Str :================================================= :RP:SCP|4->169|1v2xA|2e-37|29.4|153/192|c.116.1.1 :============================================= :BL:SWS|1->165|Y956_LISMF|9e-56|60.1|163/169 :$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|5->147|PF00588|4e-04|27.5|138/143|SpoU_methylase