[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABE00133.1"

            "Hypothetical secreted protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRFVLRGIWLVLAIFFFVLGLVGLALPVIPQVPFFLLAIYFTSKFSPKFHNWILNNRLYK:Sequence : XXXXXXXXXXXXXXXXXXXXX :SEG|10->30|lvlaifffvlglvglalpvip 61: . . . * . .: 120 :KYLLPLKNVIRNEREVVKDKSKQVWYKVLMAKLGFIR :Sequence