[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE00133.1 lsal0 ABE00133.1 "Hypothetical secreted protein"
MRFVLRGIWLVLAIFFFVLGLVGLALPVIPQVPFFLLAIYFTSKFSPKFHNWILNNRLYK
KYLLPLKNVIRNEREVVKDKSKQVWYKVLMAKLGFIR
//