[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABE00173.1"

            "Hypothetical membrane spanning protein"
            ""

OrgPattern -----------------------1-------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------11-1-11-----------111111--11111----------1------1-------1---1-1------111-------1---------------------------------------------------1---1-------1-1-1-------------------1-------------------------------------------------------------1----------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1-----------------------11-111-1111111111-11111111111111111111111111-11111111111111111111111111111111111111--1------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQAKTHITTTLALGLPLMSLTNELTLVNVGVLAVGSLLPDIDHPSSYLGKRHKMVSGVTN:Sequence : ============================:BL:SWS|33->150|YVSG_BACSU|4e-16|45.8|107/160 : $$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|35->124|PF04307|4e-06|43.9|82/99|DUF457 61: . . . * . .: 120 :KAFGHRGITHSLLGFILIGIIVKFIQKQYLTDRIENIVFWLMLGYLLHLLEDSFSQRGVK:Sequence :============================================================:BL:SWS|33->150|YVSG_BACSU|4e-16|45.8|107/160 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|35->124|PF04307|4e-06|43.9|82/99|DUF457 121: . . + . . .: 180 :WLYPFTKSGSSFGGKFAFYKTGQLSEYLVMGFMLCLLLMEVRLFWLGNLNRLLPGVVADI:Sequence :============================== :BL:SWS|33->150|YVSG_BACSU|4e-16|45.8|107/160 :$$$$ :RP:PFM|35->124|PF04307|4e-06|43.9|82/99|DUF457 181: . * . . . .: 240 :LKTLILKVQDILNSY :Sequence