[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE00173.1 lsal0 ABE00173.1 "Hypothetical membrane spanning protein"
MQAKTHITTTLALGLPLMSLTNELTLVNVGVLAVGSLLPDIDHPSSYLGKRHKMVSGVTN
KAFGHRGITHSLLGFILIGIIVKFIQKQYLTDRIENIVFWLMLGYLLHLLEDSFSQRGVK
WLYPFTKSGSSFGGKFAFYKTGQLSEYLVMGFMLCLLLMEVRLFWLGNLNRLLPGVVADI
LKTLILKVQDILNSY
//