[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABE00186.1"

            "Hypothetical membrane spanning protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------1---------------------------------1-----------------------------------------------------------------------------------------------------------------------2--------2----11---11---------1---------------------------------------1-------------1-22-------------------------11---111-----1-----------1----------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MITFEFKKIKKSAIPITLIFFNLVGSLLGTMIFALNRKVLLDGTQAHVLWGQTVFYSSQI:Sequence : ==================================================:BL:SWS|11->145|YTRD_BACSU|4e-04|28.5|130/325 61: . . . * . .: 120 :FTPILIGIICSISCQFEESNKNWQRLLSIPVKANRIILSKITSLSLVMAISQLIVLLFYI:Sequence :============================================================:BL:SWS|11->145|YTRD_BACSU|4e-04|28.5|130/325 121: . . + . . .: 180 :IIALVLKVPFANYLLDFLLWSITGWIATITIVTIQIFLSIRLKNFAVPILISAILAMAGL:Sequence :========================= :BL:SWS|11->145|YTRD_BACSU|4e-04|28.5|130/325 181: . * . . . .: 240 :MTLFIGQGLFRIFPYAQIAVGDRARSLVPFTLSEFILFLVVNSAYIFVFYTLAVRQLKKR:Sequence 241: + . . . . *: 300 :FI :Sequence