[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE00186.1 lsal0 ABE00186.1 "Hypothetical membrane spanning protein"
MITFEFKKIKKSAIPITLIFFNLVGSLLGTMIFALNRKVLLDGTQAHVLWGQTVFYSSQI
FTPILIGIICSISCQFEESNKNWQRLLSIPVKANRIILSKITSLSLVMAISQLIVLLFYI
IIALVLKVPFANYLLDFLLWSITGWIATITIVTIQIFLSIRLKNFAVPILISAILAMAGL
MTLFIGQGLFRIFPYAQIAVGDRARSLVPFTLSEFILFLVVNSAYIFVFYTLAVRQLKKR
FI
//