[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABE00205.1"

            "Conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKKINRCLLSFLILFLALFLTGFRKMKTSDYNKVRGVIVENSNKVGLHGKVTITKLYWT:Sequence : EEEEEccTTcEEcccccTTTcccEEEEEEEcHHHHHH:Sec Str : XXXXXXXXXXXXX :SEG|9->21|llsflilflalfl : ================================:BL:SWS|29->90|SYFA_RUTMC|7e-04|29.0|62/100 61: . . . * . .: 120 :ALEIPTYHVTYTYSEKTYLDQKVVLEKNTAIHEKGSSDSYGNVPEYKESFLKQKSVQKVE:Sequence :HHTcccccEEEEEcccEE :Sec Str : XXXXXXXXXX:SEG|111->134|lkqksvqkvekktekqlkkqklgl :============================== :BL:SWS|29->90|SYFA_RUTMC|7e-04|29.0|62/100 121: . . + . . .: 180 :KKTEKQLKKQKLGLPISSFSFLSNFNHA :Sequence : :Sec Str :XXXXXXXXXXXXXX :SEG|111->134|lkqksvqkvekktekqlkkqklgl