[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABE00312.1"

            "Transcription regulator, GntR family"
            ""

OrgPattern -------------------------------------------------------------------- -21141-2---1--2------3--12-----15222-3433----21-----212--1--11-2223233--------4---4-------1------------------1-----------------------------1----------11----------------1--------------431-----1264444455514443446555474433452547777878--1222223233222321--1175425A22848A922865384331221114443222333333334334444344444443355221555312-28222222222526--23331--1-1----45-2--3---12111-3-1-222---------22--------33333332334---1------2--3113112111-421-1-111---1122-----------------------------------------------1---13311311113-1111222211111-4124431--332-2-------21---1--121--------------2----1------1------1--1----1------------------------------111-----1---------------------------1------3441-314443431355-444542154543333433445422---3123232333233333-44234441-111121111121---1-----------114----1----------22222------133232223-11-2--11-----------11-1111111211--22222222-------1-------------------------------------------23---3-1-1-- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------4---------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAELVYKNIISDLKEKIFAGKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKK:Sequence :ccccHHHHHHHHHHHHHHHTcccTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEc:Sec Str : =======================================================:RP:SCP|6->70|1e2xA1|7e-15|24.6|65/73|a.4.5.6 : =======================================================:BL:SWS|6->226|GMUR_BACSU|9e-33|34.4|218/237 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->67|PF00392|2e-09|39.3|61/64|GntR 61: . . . * . .: 120 :RGSGTFINPLYLKNESIFNYEEGSNLGISDNFRLKGKKPQTKILDFQVIKPTSELQRDLF:Sequence :ccEEEccccccccEEEEccccccccccHHHHHcccTTccEEEEEEEEEEEccHHHHHHHT:Sec Str :========== :RP:SCP|6->70|1e2xA1|7e-15|24.6|65/73|a.4.5.6 : ==================================:RP:SCP|87->234|2ooiA1|8e-31|25.7|148/157|d.190.1.2 :============================================================:BL:SWS|6->226|GMUR_BACSU|9e-33|34.4|218/237 :$$$$$$$ :RP:PFM|7->67|PF00392|2e-09|39.3|61/64|GntR : $$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|95->224|PF07702|2e-20|33.8|130/141|UTRA 121: . . + . . .: 180 :LSPEDFVYKIIRLRLFEDEPFMIETGYIPIKILPKLSRTQLESSIFAYIQSELNQTASKS:Sequence :ccTTcEEEEEEEEEEETETTEEEEEEEEEHHHHTTcTTcTTccTTTTcHHHHTTccccEE:Sec Str :============================================================:RP:SCP|87->234|2ooiA1|8e-31|25.7|148/157|d.190.1.2 :============================================================:BL:SWS|6->226|GMUR_BACSU|9e-33|34.4|218/237 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|95->224|PF07702|2e-20|33.8|130/141|UTRA 181: . * . . . .: 240 :FMSIYAEPSTSEDQNLLKLKENEPVSVMEGIFFLDNGTPFEFSQMRLHFKYLKFNTFINL:Sequence :EEEEEEEEccHHHHHHHTccTTcEEEEEEEEEEEETTEEEEEEEEEEETTTEEEccc :Sec Str :====================================================== :RP:SCP|87->234|2ooiA1|8e-31|25.7|148/157|d.190.1.2 :============================================== :BL:SWS|6->226|GMUR_BACSU|9e-33|34.4|218/237 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|95->224|PF07702|2e-20|33.8|130/141|UTRA 241: + . . . . *: 300 :D :Sequence : :Sec Str