[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABE00338.1"

            "Xaa-Pro dipeptidyl-peptidase"
PEPX_LACS1  "RecName: Full=Xaa-Pro dipeptidyl-peptidase;         EC=3.4.14.11;AltName: Full=X-Pro dipeptidyl-peptidase;AltName: Full=X-prolyl-dipeptidyl aminopeptidase;         Short=X-PDAP;"

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------1------1121------------------------------------1-----------------------------------------------------------------------------------------11111111-111111------111------------------------------------1111111111111111111-1111111111112111111111111111111111111111111111111--------------------------------------------------1-1---------------------------------------------------------------------------------------------------------------------------------111111--11-----2222-111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKFNQFAHVKVPFEQKLAELNRIAFLHAGDEDLASNHIYRLFLERAFPNFKTEAAKNHAL:Sequence :ccccccccccccHHHHHHHHHHHTccccTTccH HHHHHHHHHTcccc G:Sec Str :============================================================:RP:SCP|1->154|1lnsA1|2e-06|27.3|143/145|a.40.2.1 :============================================================:BL:SWS|1->801|PEPX_LACS1|0.0|100.0|801/801 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->154|PF09168|3e-37|50.7|152/153|PepX_N 61: . . . * . .: 120 :SNLAATENADILTYLNSSKINARVFYAVGLQLLGFEAELDFDLKDPFSAMDKLNLPYQKE:Sequence :GGccccccccHHHHHHcccccHHHHHHHHHHHTTcccTTTccTTcHHHHHHHTTcccccc:Sec Str :============================================================:RP:SCP|1->154|1lnsA1|2e-06|27.3|143/145|a.40.2.1 :============================================================:BL:SWS|1->801|PEPX_LACS1|0.0|100.0|801/801 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->154|PF09168|3e-37|50.7|152/153|PepX_N 121: . . + . . .: 180 :IHHRDDVINAWYDLLCTSTKKGQNLLDILANRGYFTQFYQLNLTEPIFFNGKAQPVFDTN:Sequence :cccHHHHHHHHHHHHHcccTTcccHHHHHHHTTccccccccc EETTEEcccccGG:Sec Str :================================== :RP:SCP|1->154|1lnsA1|2e-06|27.3|143/145|a.40.2.1 : =================:RP:SCP|164->576|1lnsA3|1e-25|38.7|403/405|c.69.1.21 :============================================================:BL:SWS|1->801|PEPX_LACS1|0.0|100.0|801/801 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1->154|PF09168|3e-37|50.7|152/153|PepX_N 181: . * . . . .: 240 :KLIHEVVYVESELDTDQDGKRDLLKVIITRPAMTDNGMKVPTIFTASPYYLGTNDASAEK:Sequence :GcEEEEEEEEccccTTccccccEEEEEEEEccccc cEEEEEEEcccTTcccHHHHHH:Sec Str :============================================================:RP:SCP|164->576|1lnsA3|1e-25|38.7|403/405|c.69.1.21 :============================================================:BL:SWS|1->801|PEPX_LACS1|0.0|100.0|801/801 241: + . . . . *: 300 :MMHSVDLPITRKEVKPLSYQDIEYHKPETKLPKKRPVVISTKNAEESWEHLFTYTFNDYM:Sequence :HcccccEEEEEEEEEcTTccEEEEEEEEETTcccEEEEEHTcccTTcccHHHHccGGGHH:Sec Str :============================================================:RP:SCP|164->576|1lnsA3|1e-25|38.7|403/405|c.69.1.21 :============================================================:BL:SWS|1->801|PEPX_LACS1|0.0|100.0|801/801 301: . . . . + .: 360 :LARGFAVVYSGGVGTLDSDGYRTCGDEAETLGAKDVVEWLNGKRTAFTTKEANKAIPAWW:Sequence :HHTTcEEEEEEcTTcTTccccccTTcccccTTccccccHHHHHHHHHHHHHHccTTEEEE:Sec Str :============================================================:RP:SCP|164->576|1lnsA3|1e-25|38.7|403/405|c.69.1.21 :============================================================:BL:SWS|1->801|PEPX_LACS1|0.0|100.0|801/801 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|303->503|PF02129|9e-20|36.5|178/238|Peptidase_S15 361: . . . * . .: 420 :SNGKVAMTGKSYLGTLATAAATTGVAGLETIISEAAISSWYDYYREGGLVIAPGGFPGED:Sequence :EEEEEEEEEEEHHHHHHHHHHTcccTTEEEEEEEEEcccTTTccccEETTEEcTTHHHHH:Sec Str : XXXXXXXXXXXXXXXXXX :SEG|373->390|lgtlataaattgvaglet :============================================================:RP:SCP|164->576|1lnsA3|1e-25|38.7|403/405|c.69.1.21 :============================================================:BL:SWS|1->801|PEPX_LACS1|0.0|100.0|801/801 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|303->503|PF02129|9e-20|36.5|178/238|Peptidase_S15 421: . . + . . .: 480 :ADILAEECFSRQKSAGDYNHSKDGFNKFLSTITKDQDRTTGNYNTFWDARNYLKDVGNIK:Sequence :HHHHcccccccccccccccHHHHHHHHccHHHHHHHHcccccHHHHTTcHHHHHHHHccc:Sec Str :============================================================:RP:SCP|164->576|1lnsA3|1e-25|38.7|403/405|c.69.1.21 :============================================================:BL:SWS|1->801|PEPX_LACS1|0.0|100.0|801/801 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|303->503|PF02129|9e-20|36.5|178/238|Peptidase_S15 481: . * . . . .: 540 :CDIVMVHGLNDWNVKLKNVFNLYNKLGDVEVTKKLILHQGQHIYINNFQSLDFTDMMNLW:Sequence :ccEEEEEETTccccccHHHHHHHHHHHTTccccEEEEEEcccTTGGGccccEETTEEccc:Sec Str :============================================================:RP:SCP|164->576|1lnsA3|1e-25|38.7|403/405|c.69.1.21 :============================================================:BL:SWS|1->801|PEPX_LACS1|0.0|100.0|801/801 :$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|303->503|PF02129|9e-20|36.5|178/238|Peptidase_S15 541: + . . . . *: 600 :LSHKLYGVENNAKELLPDILVQNNTKESTWETYSSWQSKNFTKLYLNSDSLSAQKKENQT:Sequence :cHHHHHHHHTHHHHHHETTTTEEEEEcccccccccccccccEEEEEEGGGEEEccccccc:Sec Str :==================================== :RP:SCP|164->576|1lnsA3|1e-25|38.7|403/405|c.69.1.21 : =======================:RP:SCP|578->800|1lnsA2|5e-54|28.8|208/213|b.18.1.13 :============================================================:BL:SWS|1->801|PEPX_LACS1|0.0|100.0|801/801 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|552->798|PF08530|1e-08|30.3|195/209|PepX_C 601: . . . . + .: 660 :LEFSDHLPETTFKHYQTDIANWKEEILASTSPKLETNRLILTSKPLKHETLLKGVAKIKL:Sequence :EEEEccccccccccTTcHHHHTTGGGcccHHHHTcTTEEEEEcccccccEEEEEccEEEE:Sec Str :============================================================:RP:SCP|578->800|1lnsA2|5e-54|28.8|208/213|b.18.1.13 :============================================================:BL:SWS|1->801|PEPX_LACS1|0.0|100.0|801/801 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|552->798|PF08530|1e-08|30.3|195/209|PepX_C 661: . . . * . .: 720 :KIASQLDHGLVSVKLVDYGDAKRLGATPTILERRGLDLGYHWKEDNLVEFKLAKETPFKM:Sequence :EEEEcccccEEEEEEEEEcccccTTcccEEEEEEEEcGGGTTcEEEEEEccEE EEEEEE:Sec Str :============================================================:RP:SCP|578->800|1lnsA2|5e-54|28.8|208/213|b.18.1.13 :============================================================:BL:SWS|1->801|PEPX_LACS1|0.0|100.0|801/801 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|552->798|PF08530|1e-08|30.3|195/209|PepX_C 721: . . + . . .: 780 :ITQAHLNLQNRHNDFSTDELEANKFYDVEITTQPMFYHLPKGHKLGLVIYATDMEMTLQG:Sequence :EEEEEEEGGGcccccccccccTTccEEEEEEcccEEEEEcTTcEEEEEEEccccTTcccc:Sec Str :============================================================:RP:SCP|578->800|1lnsA2|5e-54|28.8|208/213|b.18.1.13 :============================================================:BL:SWS|1->801|PEPX_LACS1|0.0|100.0|801/801 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|552->798|PF08530|1e-08|30.3|195/209|PepX_C 781: . * . . . .: 840 :NEENSYRIDTTGSYCLLPIEE :Sequence :cccccccGGGccGGGcccEE :Sec Str :==================== :RP:SCP|578->800|1lnsA2|5e-54|28.8|208/213|b.18.1.13 :===================== :BL:SWS|1->801|PEPX_LACS1|0.0|100.0|801/801 :$$$$$$$$$$$$$$$$$$ :RP:PFM|552->798|PF08530|1e-08|30.3|195/209|PepX_C