[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABE00427.1"

            "Amino acid ABC transporter, ATP-binding protein"
            ""

OrgPattern TTMASHHIUUTRUQXNlHPPNPMVvJNkoUhUIBDDEBHGHFDSZSWnLQ**i8TdQRVLTJJEX18A UclN*ZZahhjUaRXSSML-LfAAW*MMMMMNpjikm***U*X*p*qZpkbP*zuKQd99suyd*mx***cZUTTzaYbN*iiBCDBCRQQH6KEGJ--EHSJLJbNYJP9A99A9ABCCBBBBJTNJQYOLRSXNfppy*LKI*XvjnsedmdhSUJFLGOFbdWh***aLOHLJMJOJLGJgYZQOxoBTZz************************gmw**drwuvqsv**ajkmlmggikjjjhjXdZbfycXZ**XPZVdsrQR**cXQWkjgggnmrqnlturqntoqmmrsmorYZZYZZZabbaXZ*kiYXZljmil*z*********i*nq***cghe*niyy*dnSK**tlZafnTYleokNfYVObURRLJMLJLcX***YSq****************-lp*jf*n***TB**************IIK**********ONOOOOOOxbfIOhR*55455555556788DE88B97988A7595MDCDEE************xxzu********j********BOzzo*kuov******dnmOTKSmUHJJIHIJTQNZnnc**NeUxmVjudbqLcaWVTYgWZaWXZoxX*PLLPHNNNPKHCCCEDDECDHUGGJLLkksMtScKUP*QUXZVNTZWSTRPUYVUZY5-ELSNM32-333****Z*xy***z***xy-*yx**********vvxvuu*****hkjnmjkmnnmmmkknkkl*snpttuvS4************34JGDECDENOQOML*o*bbacWXJQTOOTOTgPRTRRITIQSpZrqrrv***u**tzg***FFEDDEFDFMgro*rrssr*****ONLLJLKFHGCBBB75NUSSJKLLAA8A99A9*BaEBCDD-8FEDHGCPOMBIKCGHBBBclwWUq*rpqEbL 2133PP9-NB39HTJC7FACHJDNBNEDE8A89IHH8IDFEDF889EDGLJGRLGGJ9CDAD94735625535667414455555567-7C476B78888738IEB2BOUULTNdSTD8B7BMGeh6e8**a2XLbGAC5W7EaN7J889S89*DPKHmFZ*AgHN9mMP*PWOHBBB9*7667IXQW*CnZEFaRVU8 ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLRLENVNKTFGGNLALKDITTTFENNQTTVLVGPSGSGKSTMLRSLNLLEMPESGKYYF:Sequence :============================================================:RP:SCP|1->241|1b0uA|4e-52|37.3|241/258|c.37.1.12 :============================================================:BL:SWS|1->240|TCYC_BACSU|3e-62|47.5|240/247 : $$$$$$$$$$$$$$$$$$$$:RP:PFM|41->169|PF00005|3e-20|50.8|120/123|ABC_tran 61: . . . * . .: 120 :DDLELDFKKGISKKEILEVRRETEMVFQNYNLFPHLTVLKNIIEGPVHVLKEDKESATKR:Sequence :============================================================:RP:SCP|1->241|1b0uA|4e-52|37.3|241/258|c.37.1.12 :============================================================:BL:SWS|1->240|TCYC_BACSU|3e-62|47.5|240/247 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|41->169|PF00005|3e-20|50.8|120/123|ABC_tran 121: . . + . . .: 180 :AYELLKKVGLADKADAYPQQLSGGQAQRVAIARSLAMNPRYILLDEPTSALDPELELEVL:Sequence : XXXXXXX:SEG|174->191|elelevlkvllqlakekq : ############### :PROS|141->155|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|1->241|1b0uA|4e-52|37.3|241/258|c.37.1.12 :============================================================:BL:SWS|1->240|TCYC_BACSU|3e-62|47.5|240/247 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|41->169|PF00005|3e-20|50.8|120/123|ABC_tran 181: . * . . . .: 240 :KVLLQLAKEKQSLIIVTHNLAFAQKVADKILFVEDGQILFQGPKDDFFNSDNQRIKNFLS:Sequence :XXXXXXXXXXX :SEG|174->191|elelevlkvllqlakekq :============================================================:RP:SCP|1->241|1b0uA|4e-52|37.3|241/258|c.37.1.12 :============================================================:BL:SWS|1->240|TCYC_BACSU|3e-62|47.5|240/247 241: + . . . . *: 300 :AMTLSNLD :Sequence := :RP:SCP|1->241|1b0uA|4e-52|37.3|241/258|c.37.1.12