[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE00427.1 lsal0 ABE00427.1 "Amino acid ABC transporter, ATP-binding protein"
MLRLENVNKTFGGNLALKDITTTFENNQTTVLVGPSGSGKSTMLRSLNLLEMPESGKYYF
DDLELDFKKGISKKEILEVRRETEMVFQNYNLFPHLTVLKNIIEGPVHVLKEDKESATKR
AYELLKKVGLADKADAYPQQLSGGQAQRVAIARSLAMNPRYILLDEPTSALDPELELEVL
KVLLQLAKEKQSLIIVTHNLAFAQKVADKILFVEDGQILFQGPKDDFFNSDNQRIKNFLS
AMTLSNLD
//