[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABE00428.1"

            "Amino acid ABC transporter, permease protein"
            ""

OrgPattern 11--12----------1-1111114--21-2211----1122--2222--1-1----2------2--- ----4313333321411----5--1D------666636C914225283533-769135--2221577B5A4755576631431---------------------------11111111111111-----1--4---222441111-2234223332221221--11-3322-2222--2222-1341111--27455555875566556623398556333754355555396222222222222222222246757AB885676666B93757E533388886665AA999898999986666566666666798BA98888135575645455232344423333122142331AA-4132-1111111171--11137444421M68222422222375347567R-22I22E29EK23rUUQUXVWViNOPA---36L868A35E1111111133511-4A----------111111111111111--1-5--21-5HFBHNMMLOKC9DDDFFJVEDEEADHHc77B412B9C95854C9HGNQ244----A44422222---25-11L-897C56CAAA42-23-3-------1--5-4441555554343333333-13----9AC-3-----D-1111--11111111-11-3---1--------BBNN7DEAAAAAA8AA9-AACAAAAAAAAAA9AA99BJPHON776A8A7AAAAAAAAAA8AH99899993-FCCCCCBBCCCC--5-222221111--7AF55553533323333266666-64554-GEEGIQKTBHJDF5NKL----------777A99999AA97711---------------2----------------3628----------------------132-115111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------2----2------6-----------------2---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MWHTVISSLPELISAGIKYTIPLAIVSFILGLILALVTALIRISQTKGPFLVIKAIFRFY:Sequence : HHHHHHHHHHHHHHHHHHHHHHTTGGGGGGGGGGTTccccccccHHHHH:Sec Str : =============================================:RP:SCP|16->222|2r6gG1|1e-24|19.1|199/284|f.58.1.1 : ===========================================================:BL:SWS|2->229|TCYB_BACSU|2e-59|53.7|216/234 61: . . . * . .: 120 :VWLFRSTPLLVQLFIVYFGLPYLKIKGLAPEGIKLDPFTSGIIVFSLNTGAYASETIRAA:Sequence :HHHHHHccHHH HHHHHHHHHHHTTcccccHH HHHHHHHHHHHHHHHTTcHHH:Sec Str :============================================================:RP:SCP|16->222|2r6gG1|1e-24|19.1|199/284|f.58.1.1 :============================================================:BL:SWS|2->229|TCYB_BACSU|2e-59|53.7|216/234 121: . . + . . .: 180 :ITSIPKGQWEAAASIGMTHKQALMRIIIPQAARVSLPPLANSFIGLVKDTSLAASITIVE:Sequence :HHHccTTTTTHHHHHTccTHHHHHHTTHHHHcHHHHHHHHHHHH HHHHHHHH:Sec Str :============================================================:RP:SCP|16->222|2r6gG1|1e-24|19.1|199/284|f.58.1.1 :============================================================:BL:SWS|2->229|TCYB_BACSU|2e-59|53.7|216/234 181: . * . . . .: 240 :MFEVSQQIAAENYEPLVMYCTVAVLYAILCTVLSFLQGWLEKVTSRYVATQ :Sequence :H :Sec Str :========================================== :RP:SCP|16->222|2r6gG1|1e-24|19.1|199/284|f.58.1.1 :================================================= :BL:SWS|2->229|TCYB_BACSU|2e-59|53.7|216/234