[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE00428.1 lsal0 ABE00428.1 "Amino acid ABC transporter, permease protein"
MWHTVISSLPELISAGIKYTIPLAIVSFILGLILALVTALIRISQTKGPFLVIKAIFRFY
VWLFRSTPLLVQLFIVYFGLPYLKIKGLAPEGIKLDPFTSGIIVFSLNTGAYASETIRAA
ITSIPKGQWEAAASIGMTHKQALMRIIIPQAARVSLPPLANSFIGLVKDTSLAASITIVE
MFEVSQQIAAENYEPLVMYCTVAVLYAILCTVLSFLQGWLEKVTSRYVATQ
//