[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABE00433.1"

            "Conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----1------1---------------------------------------111----------11---------------1-----------------------------------------------------1------------------------------------------------1-----------------------11-------1---111111112---111111111111111111--1--11-----11--11-11---1111111--1---1---11-11---1--1---1--1-111---1111----1-------1-1--111----1-1----1-----------1--------------------11--------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------1-1-------1-----------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------1--------1-------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSLGITIVSHVYEVANGLPRLLTQVAKDVPITTAGGTEDNDVGTSMEKIMNAFEENDADE:Sequence :ccEEEEEEcccHHHHHHHHHHHHTccTTcEEEEccccTTccccccHHHHHHHHHccTTcE:Sec Str : ========================================================:RP:SCP|5->117|3b48A1|1e-21|32.1|112/129|c.54.1.2 :============================================================:BL:SWS|1->122|DHAM_LACLA|2e-35|51.6|122/123 61: . . . * . .: 120 :ILAFYDLGSAKMNLEMAIEMTDKKVHLYDVALIEGAYTAATLLEAGVDLQEVEKQLEPLK:Sequence :EEEEEccTHHHHHHHHHHTccHTTEEEccccHHHHHHHHHHHHTTcccHHHHHHHHHTcc:Sec Str :========================================================= :RP:SCP|5->117|3b48A1|1e-21|32.1|112/129|c.54.1.2 :============================================================:BL:SWS|1->122|DHAM_LACLA|2e-35|51.6|122/123 121: . . + . . .: 180 :IK :Sequence :cc :Sec Str :== :BL:SWS|1->122|DHAM_LACLA|2e-35|51.6|122/123