[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE00433.1 lsal0 ABE00433.1 "Conserved hypothetical protein"
MSLGITIVSHVYEVANGLPRLLTQVAKDVPITTAGGTEDNDVGTSMEKIMNAFEENDADE
ILAFYDLGSAKMNLEMAIEMTDKKVHLYDVALIEGAYTAATLLEAGVDLQEVEKQLEPLK
IK
//