[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABE00441.1"

            "Zinc-transporting ATPase"
            ""

OrgPattern 222-21212222222131111113C3332295555113433335444543666-11--1213322--- 4232223966854554588-8M33D6888885E8AD687933244635722174A234113463527485222223444374425326344314-1-1152637356444111111111111113213323-121145534111543BBA66843441121116844HD831111111111112734421243466666576566766663444366746354468666554543325222233332324333A875A963769783388655654879533322253322222222222333333333433334444422243564977798B888959BB65649345444433A57443442385634445337338-----6654C93A7594533342443449-6B42D877968-5556649944596D34282755552233333333373112525------------------------------2625133333633333333436634333324475458A24CD4444CA683652A5C3533642222222264639316323354535562444225235335365634232232332233332333324-147A445353232252322234342263222732---4439------33332423333334433-3433333324333333333556333324342444444424223233222231-444444444444---31111-568983312111111-11111-11322332234355556856554467645552121-21-16333333333333333211211111----1123652222--------31731321-1122211111-231112221141113111456 23--A86-524166757768786747966776796799798997776579BDGF9B987576547343-6436583724646777834-5A373321111134E9H-75839E8DDM5553575GS4K5e*E1MBT4577B56B846554C32S5D89916KD5262823E4D652D66v75767HFEf9LH76DB8A4 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSLIKRMSPDEKKESGVIALCLMLLILAHFIPKNITIVLYIVTYIISAYPILKEAIENIF:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|35->46|itivlyivtyii : ==============:BL:SWS|47->617|ATZN_SYNY3|e-165|51.6|568/721 61: . . . * . .: 120 :HGKWFDENFLMSVATVGALAIGQFSEAIAVMLFYRVGEIFEDLAIENSKKSITNLLDIRP:Sequence : HHHHHHHHHHTTcc:Sec Str :============================================================:BL:SWS|47->617|ATZN_SYNY3|e-165|51.6|568/721 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|89->304|PF00122|2e-21|29.6|216/236|E1-E2_ATPase 121: . . + . . .: 180 :EYANLELNGKLQQVKPELLNKGDIIIVNPGEKIAVDGVVESGEAYLNTAALTGETNPLLV:Sequence :cEEEEEcccccccccTTTTcTTccccccccccccccccccccccccccccTTcccccccc:Sec Str : =====================================================:RP:SCP|128->217|1iwoA1|3e-12|22.2|90/115|b.82.7.1 :============================================================:BL:SWS|47->617|ATZN_SYNY3|e-165|51.6|568/721 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|89->304|PF00122|2e-21|29.6|216/236|E1-E2_ATPase 181: . * . . . .: 240 :TKDSQVLSGMIVENSALRIRVSKEYKDSTVVKILELVQNASEKKTKTENFITKFSQIYTP:Sequence :ccccccccccccccccccccccccTTTTTcTTccccccccccccTTTTHTTHHHHHHHHH:Sec Str :===================================== :RP:SCP|128->217|1iwoA1|3e-12|22.2|90/115|b.82.7.1 :============================================================:BL:SWS|47->617|ATZN_SYNY3|e-165|51.6|568/721 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|89->304|PF00122|2e-21|29.6|216/236|E1-E2_ATPase 241: + . . . . *: 300 :VIVISAIMLASIPPLFLGQEFQVWLYRALIFLVISCPCALVISIPLSYFGGIGASSRAGI:Sequence :HHHHHHHHHcTTTTTTTccccTTHHHHHHHHTTTTccccTTTHHHHTTTHHHHHHTTTcc:Sec Str :============================================================:BL:SWS|47->617|ATZN_SYNY3|e-165|51.6|568/721 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|89->304|PF00122|2e-21|29.6|216/236|E1-E2_ATPase 301: . . . . + .: 360 :LVKGSNYLEALSQAKAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLAAIAESSSPHP:Sequence :ccccGGGHHHHTTccccEEEccccccccccccccccccccTTHHHHHHHHHHHccccccc:Sec Str : ####### :PROS|320->326|PS00154|ATPASE_E1_E2|PDOC00139| : ==============================================:RP:SCP|315->560|1rlmA|9e-27|13.5|244/269|c.108.1.10 :============================================================:BL:SWS|47->617|ATZN_SYNY3|e-165|51.6|568/721 :$$$$ :RP:PFM|89->304|PF00122|2e-21|29.6|216/236|E1-E2_ATPase : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|314->525|PF00702|1e-09|34.4|180/195|Hydrolase 361: . . . * . .: 420 :IARSIVKNYPGNIARVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTTG:Sequence :HHHHHHHTTccTTccccccccccccccccccccccccccccccccTTTTTHHHHHHHccc:Sec Str :============================================================:RP:SCP|315->560|1rlmA|9e-27|13.5|244/269|c.108.1.10 :============================================================:BL:SWS|47->617|ATZN_SYNY3|e-165|51.6|568/721 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|314->525|PF00702|1e-09|34.4|180/195|Hydrolase 421: . . + . . .: 480 :TVVYVALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNI:Sequence :ccccccccccccEEEEEcccccHHHHHHHHHHHHTTcEccEEEEcccHHHHTHHHHTTTc:Sec Str :============================================================:RP:SCP|315->560|1rlmA|9e-27|13.5|244/269|c.108.1.10 :============================================================:BL:SWS|47->617|ATZN_SYNY3|e-165|51.6|568/721 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|314->525|PF00702|1e-09|34.4|180/195|Hydrolase 481: . * . . . .: 540 :PNVKTELLPQDKVTEVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAV:Sequence :TccEEcccHHHHHHHHHHHHHTHHHTccccccccccTTHHHHHHcccccccHcccHHHHG:Sec Str :============================================================:RP:SCP|315->560|1rlmA|9e-27|13.5|244/269|c.108.1.10 :============================================================:BL:SWS|47->617|ATZN_SYNY3|e-165|51.6|568/721 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|314->525|PF00702|1e-09|34.4|180/195|Hydrolase 541: + . . . . *: 600 :EVADVVLMKDNPTAVTRVIKIARKTKMIVWENIIFALMVKVIFLLVGALGIATMWEAVFA:Sequence :GGcccccccccHHHHTHHHHTHHHHHHHHHHHHHHHHHHTTTTTcTTHHHHccccccccH:Sec Str :==================== :RP:SCP|315->560|1rlmA|9e-27|13.5|244/269|c.108.1.10 :============================================================:BL:SWS|47->617|ATZN_SYNY3|e-165|51.6|568/721 601: . . . . + .: 660 :DVGVTFIAILNALRLLKMKEENKKINKYPHSKTEKYKVEVNEA :Sequence :HHHHHHHHHHHHTTTccccccccccccccHHHHHccHHHHHHH :Sec Str :================= :BL:SWS|47->617|ATZN_SYNY3|e-165|51.6|568/721