[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABE00455.1"

            "Hypothetical protein, phage associated"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MILINGIPASKELITIFSMVKGATLENPVKTKDLKNATGLSERMIRDGINNLRFTYSVPI:Sequence 61: . . . * . .: 120 :GSIRHATNAGYYFIRSETDLIACIAPIRAQAREELNVVNKLKDNLNNWRW :Sequence : XXXXXXXXXXXXX :SEG|95->107|lnvvnklkdnlnn