[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE00455.1 lsal0 ABE00455.1 "Hypothetical protein, phage associated"
MILINGIPASKELITIFSMVKGATLENPVKTKDLKNATGLSERMIRDGINNLRFTYSVPI
GSIRHATNAGYYFIRSETDLIACIAPIRAQAREELNVVNKLKDNLNNWRW
//