[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABE00459.1"

            "Hypothetical protein, phage associated"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-1---22--1212-1--113-----------------------21---22-1------------1------------------------7--------------------------------------------------------------------1--------------------------------------------1-------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------1-------------------------------------------1111------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNRLDQVIEMVQRGLYVYPIVPNGKQPIKDYSYLKATQDIALIKRWFMDEPNINIGLNLA:Sequence : ==========================================================:RP:SCP|3->114|1rniA|9e-12|24.5|106/210|d.264.1.2 : =====:BL:SWS|56->152|HUTI_PSEF5|3e-05|26.6|94/401 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->155|PF09250|3e-18|37.6|141/163|Prim-Pol 61: . . . * . .: 120 :KSNLIIVDIDNHNNDLQAPLQSLSNLGYNLPSDYVERTKSGGLHFYYRCSDGIPATRKTK:Sequence :====================================================== :RP:SCP|3->114|1rniA|9e-12|24.5|106/210|d.264.1.2 :============================================================:BL:SWS|56->152|HUTI_PSEF5|3e-05|26.6|94/401 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->155|PF09250|3e-18|37.6|141/163|Prim-Pol 121: . . + . . .: 180 :FIDGVDLLSDFVVTSPSTNYKILNGATLDDIPQTPNWIIKALDNRAMPTDKMQDNPTPYR:Sequence :================================ :BL:SWS|56->152|HUTI_PSEF5|3e-05|26.6|94/401 : ====================================================:BL:SWS|129->210|XYNA_PENCH|4e-04|30.9|81/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|13->155|PF09250|3e-18|37.6|141/163|Prim-Pol 181: . * . . . .: 240 :RYYTGYLIDEIVNGVDAGNRNNWIASIFGKLLRAGASPKNAYSLLQLINDNYVQPPLPAK:Sequence :============================== :BL:SWS|129->210|XYNA_PENCH|4e-04|30.9|81/100 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|194->251|PF08708|4e-04|33.3|57/66|PriCT_1 241: + . . . . *: 300 :ELDNVAESILKRFINE :Sequence :$$$$$$$$$$$ :RP:PFM|194->251|PF08708|4e-04|33.3|57/66|PriCT_1