[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE00459.1 lsal0 ABE00459.1 "Hypothetical protein, phage associated"
MNRLDQVIEMVQRGLYVYPIVPNGKQPIKDYSYLKATQDIALIKRWFMDEPNINIGLNLA
KSNLIIVDIDNHNNDLQAPLQSLSNLGYNLPSDYVERTKSGGLHFYYRCSDGIPATRKTK
FIDGVDLLSDFVVTSPSTNYKILNGATLDDIPQTPNWIIKALDNRAMPTDKMQDNPTPYR
RYYTGYLIDEIVNGVDAGNRNNWIASIFGKLLRAGASPKNAYSLLQLINDNYVQPPLPAK
ELDNVAESILKRFINE
//