[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABE00490.1"

            "Transcriptional regulator, TetR family"
            ""

OrgPattern ---------------------------------------------1---------------------- -2--1-------1-----------------------------------------------------1-------------24-1------------------------------------------------------------1----------------------------------------------2--33333232233232311223-232---361111111-2711112111111111141-431-1----4--122112313114-22223212225331111111111111221111111114111111112---48----------1-22-1112---1-1----21----------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MHQNDLRVRKTRAKIKRALIETINEKGFGNLTVSDITERAGINRGTFYIHYKGKQDLLEQ:Sequence : cccccccHHHHHHHHHHHHHHHTTTcccHHHHHHHHTccHHHHHHHcccHHHHHHH:Sec Str : =======================================================:RP:SCP|6->75|1ui5A1|3e-14|31.4|70/71|a.4.1.9 : ==========================================================:BL:SWS|3->82|YXBF_BACSU|3e-10|39.5|76/380 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|18->61|PF00440|5e-06|40.9|44/47|TetR_N 61: . . . * . .: 120 :LEEAIYSDIIQLFHDNGTISSATSYEDLNRQFFQKFSAYIYGERYFILAIVLGNGDPMFY:Sequence :HHHHHHHHHccccccTTccccccHHHHHHHHHHHHHHHHHHccTTHHHHHHHccccHHHH:Sec Str :=============== :RP:SCP|6->75|1ui5A1|3e-14|31.4|70/71|a.4.1.9 :====================== :BL:SWS|3->82|YXBF_BACSU|3e-10|39.5|76/380 : ===:BL:SWS|118->161|ST1E1_BOVIN|6e-04|34.1|44/295 :$ :RP:PFM|18->61|PF00440|5e-06|40.9|44/47|TetR_N 121: . . + . . .: 180 :HKIKQILTRELLKRMEYLGIKMSDEIPHEYIEEYAIGSMLNLSIYWLEKDNPEPPNEFAK:Sequence :HHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHTcccHHHHH:Sec Str :========================================= :BL:SWS|118->161|ST1E1_BOVIN|6e-04|34.1|44/295 181: . * . . . .: 240 :IMMRTRTKAPLAFAVKE :Sequence :HHHHHHHcc :Sec Str