[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:adeC"

adeC        "Adenine deaminase"
ADEC_LACS1  "RecName: Full=Adenine deaminase;         Short=Adenase;         Short=Adenine aminase;         EC=3.5.4.2;"

OrgPattern --1-1------------------1--------111111-----11-1-111111-------1--1-11 ---1--------------------------------------11------------------------------------1-2----------1--------1--1-11--------------------------------111-1-------------------------------------111------22111111-1-111-11322222111132222211111131--------------------1--1-------11----21-112------------------------------------------------22121111111111-1---11-----------1121----21---------------------221--------11111111111-1111111111--422222154244-----1211111111---------111-----------------------------------------------------------------1--------------------------------------------111-2-11-1111------2----------11------------------------1--------------------1--------------------------1-1--1111111111-11111-1111111111111111---------------------11111111---------------------------------------------------------------------------------------------------------------------1------121----------------------------------1111-1---11- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEKQKLIKLIDVAAGRKKADLVLKNAKIVDVFQAKILTGDIAISDGYIAGIGGSYQGVVE:Sequence :cccEEEE cccccGGGccEEEEccEEEcTTccEEEEcEEEEETTEEEEEETcccccEE:Sec Str : ==========================================:RP:SCP|19->70|1m7jA1|6e-09|23.1|52/55|b.92.1.6 :============================================================:BL:SWS|1->578|ADEC_LACS1|0.0|100.0|578/578 61: . . . * . .: 120 :CNYTGKYVAPGFIEAHIHIESSYVSPEEFSRVFIPRGTTTILADPHEIVNVAGLKGLDYM:Sequence :EEcTTcEEEEcEEEEEEcTcGGGccccccHHHHHHTTEEEEEEccccccccccHHHHHHH:Sec Str :========== :RP:SCP|19->70|1m7jA1|6e-09|23.1|52/55|b.92.1.6 : ==========================================================:RP:SCP|63->328|1k6wA2|7e-21|14.3|259/320|c.1.9.5 :============================================================:BL:SWS|1->578|ADEC_LACS1|0.0|100.0|578/578 121: . . + . . .: 180 :VNAAKNAKMDIRYMMPPCVPATNFETSGADLYADDMEDALKTGEVDGLAELMNFPGVINA:Sequence :HHHHHHHTcEEEEEEEccccccccccccHHHHHHHcTTEEEEEEEccTTcccccHHHHHH:Sec Str :============================================================:RP:SCP|63->328|1k6wA2|7e-21|14.3|259/320|c.1.9.5 :============================================================:BL:SWS|1->578|ADEC_LACS1|0.0|100.0|578/578 181: . * . . . .: 240 :DDKMIDEILMAKKYGARIDGHAPQVVGKDLNAYIAAGPANDHECSTLEEAEERLARGMYL:Sequence :HHHHHHHHHHHHTcccEEEEEHHHHHHccccGGGEEEEcGGGcHHHHHHHHHHHHTTccE:Sec Str :============================================================:RP:SCP|63->328|1k6wA2|7e-21|14.3|259/320|c.1.9.5 :============================================================:BL:SWS|1->578|ADEC_LACS1|0.0|100.0|578/578 241: + . . . . *: 300 :LLREGSVTQDLRKLLPIVNTANSRRCLLSGDDVQAKTAINKGHLDNSIRICIDEGLNPIT:Sequence :EEETTccccccHHHHHHHHTTccGGGEEEEcccTccccccHHHHHHHHHHHHHHcccHHH:Sec Str :============================================================:RP:SCP|63->328|1k6wA2|7e-21|14.3|259/320|c.1.9.5 :============================================================:BL:SWS|1->578|ADEC_LACS1|0.0|100.0|578/578 : $$$$$$$$$$$$$:RP:PFM|288->333|PF01979|8e-07|43.5|46/271|Amidohydro_1 301: . . . . + .: 360 :AIQMATLNPAEYCGLNDRGAIAPGRRADMVVFESLEDFAVEETYILGEKLSQGNEYLGEV:Sequence :HHGGGTHHHHHHHTcTTcccccTTccccEEEEcTTTTccEEEEEETTEEEEETTEEcccT:Sec Str :============================ :RP:SCP|63->328|1k6wA2|7e-21|14.3|259/320|c.1.9.5 :============================================================:BL:SWS|1->578|ADEC_LACS1|0.0|100.0|578/578 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|288->333|PF01979|8e-07|43.5|46/271|Amidohydro_1 361: . . . * . .: 420 :NYYPIDSVESSMHVKDFTREKLQLHLNSDKVRAIGVVPGEVLTTEEHVTVKRDGDGNFVY:Sequence :Tccccccc :Sec Str :============================================================:BL:SWS|1->578|ADEC_LACS1|0.0|100.0|578/578 421: . . + . . .: 480 :NDQEDVTKIVVVERHHNTGNVNVNLLSGYGIKAGAIAISIGHDSHNIIATGTNDDDIFMA:Sequence : :Sec Str : XXXXXXXXXXXXXX :SEG|448->461|gygikagaiaisig :============================================================:BL:SWS|1->578|ADEC_LACS1|0.0|100.0|578/578 481: . * . . . .: 540 :VNELIKQEGGAVVVKDEKVISRMELKIAGLMCNLPAEKMIAQQDALDEAVHEELGVPDNV:Sequence : :Sec Str : ############################## :PROS|482->511|PS00189|LIPOYL|PDOC00168| :============================================================:BL:SWS|1->578|ADEC_LACS1|0.0|100.0|578/578 541: + . . . . *: 600 :NPVMTLSFMPLAVIPKLKITDKGLVDVEKNAFVSNELD :Sequence : :Sec Str :====================================== :BL:SWS|1->578|ADEC_LACS1|0.0|100.0|578/578