[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:aes"

aes         "Endo-1,4-beta-xylanase"
            ""

OrgPattern -----------------1-------------------------------------------------- 212-----------------------------------11--------1---111----------------1111111----------2132-2-----1-2--22-3-3-------------------------------------1---------------------------------------------------------------111------------------1---------------------221--112-14411--111---111--------11----------------------------------1--1-------------------4-----2----------------1-----21111-----1------------------------111111121---1111----------1-1-------------------11------------------------------------1-1------------1111-----1111-1----------------------------------------------------------------------1--------------------------------------1-------------------------------------1111-11---2-------------2-----2-------1-11-----------------------------111111111111---------------------------------------1----1-------------------------------------1-----12222----------------------------------------------------------------41 --------------1----1------------------------------12-2------------------------------------------------------3-------------------------------------------------------------8-----------------------1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQKITEKITVAGHTAELMGYTIEKKNDWGVQDKHATIIICPGGGYHFVSDREADPVALKL:Sequence :HHTTcccccEEccccEEEEEEccccccccccccEEEEEEcccTTTcccTTcGGGccHHHH:Sec Str : ====================================================:RP:SCP|9->272|1evqA|3e-19|22.3|238/308|c.69.1.2 : ============================:BL:SWS|33->243|XYNB_BUTFI|2e-41|40.4|208/635 : $$$$$$$$$$$$$$$$$$$:RP:PFM|42->239|PF07859|7e-13|33.1|181/205|Abhydrolase_3 61: . . . * . .: 120 :ITMGYNAFVLNYTCQVRYPVALEQLAQSVKLVRDNADEWNVREDKIIIMGMSAGGHLAAS:Sequence :HHHTcEEEEEcccTTccccHHHHHHHHHHHHHHHHGGGGTEEEEEEEEEEETHHHHHHHH:Sec Str :============================================================:RP:SCP|9->272|1evqA|3e-19|22.3|238/308|c.69.1.2 :============================================================:BL:SWS|33->243|XYNB_BUTFI|2e-41|40.4|208/635 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|42->239|PF07859|7e-13|33.1|181/205|Abhydrolase_3 121: . . + . . .: 180 :LGVKWNSNELKQMGYKSEEIKPNGLVLSYPVITTNKDFWHQGSFEQILGKDGIEDEKALA:Sequence :HTTcGGGTTcccEEEEEccccccccHHHHHHHHHHHHHHTTccTTcTTGGGTccHHHHHH:Sec Str :============================================================:RP:SCP|9->272|1evqA|3e-19|22.3|238/308|c.69.1.2 :============================================================:BL:SWS|33->243|XYNB_BUTFI|2e-41|40.4|208/635 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|42->239|PF07859|7e-13|33.1|181/205|Abhydrolase_3 181: . * . . . .: 240 :NQSLEKLVTEDVPPVFMWHTFEDKAVPMENSLLFASALRKAGVSTEYHIFPHGPHGLALA:Sequence :HHHHHHHHTTccTTcccccccccTTTccccHHHHHHTTTTTTccEEEEEETTGGGGTccT:Sec Str :============================================================:RP:SCP|9->272|1evqA|3e-19|22.3|238/308|c.69.1.2 :============================================================:BL:SWS|33->243|XYNB_BUTFI|2e-41|40.4|208/635 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|42->239|PF07859|7e-13|33.1|181/205|Abhydrolase_3 241: + . . . . *: 300 :NEETARVGRPEDIEPQAAQWVDLFHSWMQALLK :Sequence :TcccccHHHHHHHHHHHHHHHHHHHccccHHTc :Sec Str :================================ :RP:SCP|9->272|1evqA|3e-19|22.3|238/308|c.69.1.2 :=== :BL:SWS|33->243|XYNB_BUTFI|2e-41|40.4|208/635