[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:comFC"

comFC       "ComF operon protein 3"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111--111111111111111-----111-11-111111111111111111111111-11111111111111111111111111111111111111---------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNCLLCNNTIDFKLNIKWILSLEKYKRDNVCKRCREELGKCKIDNACEGCGREQKKLLLC:Sequence : :Sec Str :============================================================:BL:SWS|1->228|COMFC_BACSU|1e-25|34.4|221/229 61: . . . * . .: 120 :NDCIKWKNNNKILLNNKSIYTYDNLIIKKYFERYKFMGDYYWRKIFNIEFKNFITNNYPS:Sequence : ccEEGTTccHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHTccE:Sec Str : XXXXXXXXXXXXXX :SEG|64->77|ikwknnnkillnnk :============================================================:BL:SWS|1->228|COMFC_BACSU|1e-25|34.4|221/229 121: . . + . . .: 180 :KDWIYIPIPVDEYTMQHRGFNQVEGLIGDLPYSRVLKMKKLKRDKKQSEKSRSERLKTQQ:Sequence :EEEEEEEEEccHHHHHHHHHHHHHHTcccTHHHHHHHHHHTcccEEEEEEEccEETTEEc:Sec Str : XXXXXXXXXX :SEG|157->166|kmkklkrdkk : ====:RP:SCP|177->227|1u9yA2|5e-06|25.5|51/119|c.61.1.2 :============================================================:BL:SWS|1->228|COMFC_BACSU|1e-25|34.4|221/229 : $$$$$$$$$$$$$:RP:PFM|168->227|PF00156|4e-04|35.0|60/116|Pribosyltran 181: . * . . . .: 240 :PFEYIGDKLQGNYVIIDDVYTTGRTLYYAQELLLKNGASRVCSVTLAR :Sequence :cEEEEccccccTEEEEEEEEcccHHHHHHHHHcTTcEEEEEEEcTTTG :Sec Str :=============================================== :RP:SCP|177->227|1u9yA2|5e-06|25.5|51/119|c.61.1.2 :================================================ :BL:SWS|1->228|COMFC_BACSU|1e-25|34.4|221/229 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|168->227|PF00156|4e-04|35.0|60/116|Pribosyltran