[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE00014.1 lsal0 comFC "ComF operon protein 3"
MNCLLCNNTIDFKLNIKWILSLEKYKRDNVCKRCREELGKCKIDNACEGCGREQKKLLLC
NDCIKWKNNNKILLNNKSIYTYDNLIIKKYFERYKFMGDYYWRKIFNIEFKNFITNNYPS
KDWIYIPIPVDEYTMQHRGFNQVEGLIGDLPYSRVLKMKKLKRDKKQSEKSRSERLKTQQ
PFEYIGDKLQGNYVIIDDVYTTGRTLYYAQELLLKNGASRVCSVTLAR
//